PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.156340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 276aa    MW: 31651.2 Da    PI: 8.3992
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.156340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.5e-142774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+++++  g+ R++k+c++rw +yl
   Cucsa.156340.1 27 RGPWTVEEDHKLMNFILNNGIHCWRLVPKLAGLLRCGKSCRLRWINYL 74
                     89******************************99************97 PP

2Myb_DNA-binding56.18.8e-1880123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+ E+ ++++++ +lG++ W++Ia++++ gRt++++k++w++
   Cucsa.156340.1  80 RGAFTEMEENQIIHLHSLLGNR-WSKIAAHFP-GRTDNEIKNHWNT 123
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-211877IPR009057Homeodomain-like
PROSITE profilePS5129414.0112274IPR017930Myb domain
SuperFamilySSF466892.16E-2824121IPR009057Homeodomain-like
SMARTSM007173.0E-82676IPR001005SANT/Myb domain
PfamPF002492.1E-122774IPR001005SANT/Myb domain
CDDcd001674.18E-62974No hitNo description
PROSITE profilePS5129426.58175129IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2578130IPR009057Homeodomain-like
SMARTSM007179.9E-1779127IPR001005SANT/Myb domain
PfamPF002493.9E-1680123IPR001005SANT/Myb domain
CDDcd001675.66E-1282123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MQTIAVVSHR DRDMVRQPCC DKVGLKRGPW TVEEDHKLMN FILNNGIHCW RLVPKLAGLL  60
RCGKSCRLRW INYLRPDLKR GAFTEMEENQ IIHLHSLLGN RWSKIAAHFP GRTDNEIKNH  120
WNTRIKKRLK QLGLDPLTHK KLTEKTDRLK EQLFSLRTQE AIMPNFDFET KEIIPISSHM  180
LSSDGSSNLV CKGIGYEMWM GQLESNSNAS FSLEYCSSMN ESLSIIKQNS VQFDSLDSLP  240
SCSWDDGVPK FNKLEKDDIY SLGNGGGYYI DTFSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29251295108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818570.0LN681857.1 Cucumis melo genomic scaffold, anchoredscaffold00023.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004145682.20.0PREDICTED: uncharacterized protein LOC101219823
TrEMBLA0A067LG984e-92A0A067LG98_JATCU; MYB family protein
STRINGVIT_14s0219g00050.t012e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-81myb domain protein 40